Lineage for d1khob2 (1kho B:250-370)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163751Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 163752Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 163788Family b.12.1.3: Alpha-toxin, C-terminal domain [49738] (1 protein)
  6. 163789Protein Alpha-toxin, C-terminal domain [49739] (1 species)
  7. 163790Species Clostridium perfringens, different strains [TaxId:1502] [49740] (5 PDB entries)
  8. 163797Domain d1khob2: 1kho B:250-370 [72492]
    Other proteins in same PDB: d1khoa1, d1khob1

Details for d1khob2

PDB Entry: 1kho (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of Clostridium perfringens alpha-Toxin Isolated from Avian Strain SWCP

SCOP Domain Sequences for d1khob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khob2 b.12.1.3 (B:250-370) Alpha-toxin, C-terminal domain {Clostridium perfringens, different strains}
sanknvnelvayittggekyagtddymyfgiktkdgqtqewtmdnpgndfmtgsqdtytf
klkdknlkiddiqnmwirkskytefgddykpanikviangnvvlnkdinewisgnstyni
k

SCOP Domain Coordinates for d1khob2:

Click to download the PDB-style file with coordinates for d1khob2.
(The format of our PDB-style files is described here.)

Timeline for d1khob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khob1