Lineage for d1khob1 (1kho B:1-249)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730190Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2730191Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2730192Family a.124.1.1: Phospholipase C [48538] (3 proteins)
  6. 2730193Protein Alpha-toxin, N-terminal domain [48541] (2 species)
  7. 2730199Species Clostridium perfringens, different strains [TaxId:1502] [48542] (6 PDB entries)
  8. 2730202Domain d1khob1: 1kho B:1-249 [72491]
    Other proteins in same PDB: d1khoa2, d1khob2
    complexed with zn

Details for d1khob1

PDB Entry: 1kho (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of Clostridium perfringens alpha-Toxin Isolated from Avian Strain SWCP
PDB Compounds: (B:) alpha-toxin

SCOPe Domain Sequences for d1khob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khob1 a.124.1.1 (B:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
wdgkadgtgthamiatqgvtilendlssnepevirnnleilkqnmhdlqlgstypdydkn
aydlyqdhfwdpdtdnnftkdskwylsysipdtaesqirkfsalaryewkrgnykqatfy
lgeamhyfgdadtpyhaanvtavdspghvkfetfaedrkdqykinttgsktndafysnil
tnedfnswskefarsfaktakdlyyshanmscswdewdyaakvalansqkgtsgyiyrfl
hdvsdgkds

SCOPe Domain Coordinates for d1khob1:

Click to download the PDB-style file with coordinates for d1khob1.
(The format of our PDB-style files is described here.)

Timeline for d1khob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khob2