SCOPe 2.08: Domain d1khoa1: 1kho A:1-249

Lineage for d1khoa1 (1kho A:1-249)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
   multihelical

4. Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families)
   duplication: all chain but the N-terminal helix forms two structural repeats

5. Family a.124.1.1: Phospholipase C [48538] (3 proteins)

6. Protein Alpha-toxin, N-terminal domain [48541] (2 species)

7. Species Clostridium perfringens, different strains [TaxId:1502] [48542] (6 PDB entries)

8. Domain d1khoa1: 1kho A:1-249 [72489]
   Other proteins in same PDB: d1khoa2, d1khob2
   complexed with zn

Details for d1khoa1

PDB Entry: 1kho, 2.4 Å

PDB Description: Crystal Structure Analysis of Clostridium perfringens alpha-Toxin Isolated from Avian Strain SWCP

PDB Compounds: (A:) alpha-toxin

SCOPe Domain Sequences for d1khoa1:

Sequence; same for both SEQRES and ATOM records:

>d1khoa1 a.124.1.1 (A:1-249) Alpha-toxin, N-terminal domain {Clostridium perfringens, different strains [TaxId: 1502]}
wdgkadgtgthamiatqgvtilendlssnepevirnnleilkqnmhdlqlgstypdydkn
aydlyqdhfwdpdtdnnftkdskwylsysipdtaesqirkfsalaryewkrgnykqatfy
lgeamhyfgdadtpyhaanvtavdspghvkfetfaedrkdqykinttgsktndafysnil
tnedfnswskefarsfaktakdlyyshanmscswdewdyaakvalansqkgtsgyiyrfl
hdvsdgkds

Timeline for d1khoa1:

• d1khoa1 first appeared in SCOP 1.61
  
• d1khoa1 appears in SCOPe 2.07