SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1khna_ (1khn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138456Protein Alkaline phosphatase [53651] (4 species)
  7. 2138464Species Escherichia coli [TaxId:562] [53652] (43 PDB entries)
  8. 2138547Domain d1khna_: 1khn A: [72487]
    complexed with zn; mutant

Details for d1khna_

PDB Entry: 1khn (more details), 2.6 Å

PDB Description: e. coli alkaline phosphatase mutant (d153hd330n) zinc form
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1khna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khna_ c.76.1.1 (A:) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
vlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseitaarnya
egaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdih
ekdhptilemakaaglatgnvstaelqhatpaalvahvtsrkcygpsatsqkcpgnalek
ggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsdaaslns
vteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdk
aiellsknekgfflqvegasidkqnhaanpcgqigetvdldeavqralefakkegntlvi
vtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygph
aanvvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d1khna_:

Click to download the PDB-style file with coordinates for d1khna_.
(The format of our PDB-style files is described here.)

Timeline for d1khna_: