Lineage for d1kh5b_ (1kh5 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185039Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
  4. 185040Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 185041Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 185042Protein Alkaline phosphatase [53651] (3 species)
  7. 185043Species Escherichia coli [TaxId:562] [53652] (31 PDB entries)
  8. 185069Domain d1kh5b_: 1kh5 B: [72476]

Details for d1kh5b_

PDB Entry: 1kh5 (more details), 2 Å

PDB Description: e. coli alkaline phosphatase mutant (d330n) mimic of the transition states with aluminium fluoride

SCOP Domain Sequences for d1kh5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kh5b_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli}
vlenraaqgnitapggarrltgdqtaalrnslsdkpakniilligdgmgdseitaarnya
egaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdih
ekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsqkcpgnalek
ggkgsiteqllnaradvtlgggaktfaetatagewqgktlreeaeargyqlvsdaaslns
vteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdk
aiellsknekgfflqvegasidkqnhaanpcgqigetvdldeavqralefakkegntlvi
vtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygph
aanvvgltdqtdlfytmkaalglk

SCOP Domain Coordinates for d1kh5b_:

Click to download the PDB-style file with coordinates for d1kh5b_.
(The format of our PDB-style files is described here.)

Timeline for d1kh5b_: