SCOP 1.69: Domain d1kh2b1: 1kh2 B:1-165

Lineage for d1kh2b1 (1kh2 B:1-165)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)

6. Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries)

8. Domain d1kh2b1: 1kh2 B:1-165 [72467]
   Other proteins in same PDB: d1kh2a2, d1kh2b2, d1kh2c2, d1kh2d2

Details for d1kh2b1

PDB Entry: 1kh2, 2.3 Å

PDB Description: crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with atp

SCOP Domain Sequences for d1kh2b1:

Sequence; same for both SEQRES and ATOM records:

>d1kh2b1 c.26.2.1 (B:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus}
mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp

Timeline for d1kh2b1:

• d1kh2b1 first appeared in SCOP 1.61
  
• d1kh2b1 appears in SCOP 1.67
  
• d1kh2b1 appears in SCOP 1.71
  
• d1kh2b1 appears in the current release, SCOPe 2.08