Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) share similar mode of ligand (Adenosine group) binding the first three families are more closely related to each other as the last two families are |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins) |
Protein Argininosuccinate synthetase, N-terminal domain [69458] (2 species) |
Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries) |
Domain d1kh1d1: 1kh1 D:1-165 [72463] Other proteins in same PDB: d1kh1a2, d1kh1b2, d1kh1c2, d1kh1d2 complexed with so4 |
PDB Entry: 1kh1 (more details), 2.3 Å
SCOP Domain Sequences for d1kh1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kh1d1 c.26.2.1 (D:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus} mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp
Timeline for d1kh1d1: