Lineage for d1kh1d1 (1kh1 D:1-165)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312411Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 312412Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins)
  6. 312413Protein Argininosuccinate synthetase, N-terminal domain [69458] (2 species)
  7. 312419Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries)
  8. 312443Domain d1kh1d1: 1kh1 D:1-165 [72463]
    Other proteins in same PDB: d1kh1a2, d1kh1b2, d1kh1c2, d1kh1d2
    complexed with so4

Details for d1kh1d1

PDB Entry: 1kh1 (more details), 2.3 Å

PDB Description: crystal structure of thermus thermophilus hb8 argininosuccinate synthetase

SCOP Domain Sequences for d1kh1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kh1d1 c.26.2.1 (D:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus}
mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp

SCOP Domain Coordinates for d1kh1d1:

Click to download the PDB-style file with coordinates for d1kh1d1.
(The format of our PDB-style files is described here.)

Timeline for d1kh1d1: