Lineage for d1kgyg_ (1kgy G:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.5: Ephrin-b2 ectodomain [74874] (1 protein) Protein Ephrin-b2 ectodomain [74875] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries) 
Domain d1kgyg_: 1kgy G: [72455]
Other proteins in same PDB: d1kgya_, d1kgyb_, d1kgyc_, d1kgyd_
Details for d1kgyg_
PDB Entry: 1kgy (more details), 2.7 Å
PDB Description: crystal structure of the ephb2-ephrinb2 complex
SCOP Domain Sequences for d1kgyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgyg_ b.6.1.5 (G:) Ephrin-b2 ectodomain {Mouse (Mus musculus)}
ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg
SCOP Domain Coordinates for d1kgyg_:
Click to download the PDB-style file with coordinates for d1kgyg_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kgyg_:
- d1kgyg_ is new in SCOP 1.61
- d1kgyg_ appears in SCOP 1.63
- d1kgyg_ appears in the current release, SCOPe 2.08
View in 3D
