Lineage for d1kgyf_ (1kgy F:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224972Family b.6.1.5: Ephrin-b2 ectodomain [74874] (1 protein)
    eukaryotic signalling domain probably related to cupredoxins but lacking the metal-binding site
  6. 224973Protein Ephrin-b2 ectodomain [74875] (1 species)
  7. 224974Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries)
  8. 224977Domain d1kgyf_: 1kgy F: [72454]
    Other proteins in same PDB: d1kgya_, d1kgyb_, d1kgyc_, d1kgyd_

Details for d1kgyf_

PDB Entry: 1kgy (more details), 2.7 Å

PDB Description: crystal structure of the ephb2-ephrinb2 complex

SCOP Domain Sequences for d1kgyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgyf_ b.6.1.5 (F:) Ephrin-b2 ectodomain {Mouse (Mus musculus)}
ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

SCOP Domain Coordinates for d1kgyf_:

Click to download the PDB-style file with coordinates for d1kgyf_.
(The format of our PDB-style files is described here.)

Timeline for d1kgyf_: