![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins) eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF00812 |
![]() | Protein Ephrin-b2 ectodomain [74875] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries) |
![]() | Domain d1kgyf_: 1kgy F: [72454] Other proteins in same PDB: d1kgya_, d1kgyb_, d1kgyc_, d1kgyd_ complexed with ephb2 |
PDB Entry: 1kgy (more details), 2.7 Å
SCOPe Domain Sequences for d1kgyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgyf_ b.6.1.5 (F:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn qeggvcqtramkilmkvg
Timeline for d1kgyf_: