Lineage for d1kgye_ (1kgy E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1775501Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 1775507Protein Ephrin-b2 ectodomain [74875] (2 species)
  7. 1775511Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries)
  8. 1775513Domain d1kgye_: 1kgy E: [72453]
    Other proteins in same PDB: d1kgya_, d1kgyb_, d1kgyc_, d1kgyd_
    complexed with ephb2

Details for d1kgye_

PDB Entry: 1kgy (more details), 2.7 Å

PDB Description: crystal structure of the ephb2-ephrinb2 complex
PDB Compounds: (E:) ephrin-b2

SCOPe Domain Sequences for d1kgye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgye_ b.6.1.5 (E:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}
ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

SCOPe Domain Coordinates for d1kgye_:

Click to download the PDB-style file with coordinates for d1kgye_.
(The format of our PDB-style files is described here.)

Timeline for d1kgye_: