Lineage for d1kgye_ (1kgy E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 163020Family b.6.1.5: Ephrin-b2 ectodomain [74874] (1 protein)
  6. 163021Protein Ephrin-b2 ectodomain [74875] (1 species)
  7. 163022Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries)
  8. 163024Domain d1kgye_: 1kgy E: [72453]
    Other proteins in same PDB: d1kgya_, d1kgyb_, d1kgyc_, d1kgyd_

Details for d1kgye_

PDB Entry: 1kgy (more details), 2.7 Å

PDB Description: crystal structure of the ephb2-ephrinb2 complex

SCOP Domain Sequences for d1kgye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgye_ b.6.1.5 (E:) Ephrin-b2 ectodomain {Mouse (Mus musculus)}
ivlepiywnssnskflpggglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

SCOP Domain Coordinates for d1kgye_:

Click to download the PDB-style file with coordinates for d1kgye_.
(The format of our PDB-style files is described here.)

Timeline for d1kgye_: