Lineage for d1kgyd_ (1kgy D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163940Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 163941Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families) (S)
  5. 163975Family b.18.1.4: Ligand-binding domain of the ephb2 receptor tyrosine kinase [49800] (1 protein)
  6. 163976Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 163977Species Mouse (Mus musculus) [TaxId:10090] [49802] (2 PDB entries)
  8. 163981Domain d1kgyd_: 1kgy D: [72452]
    Other proteins in same PDB: d1kgye_, d1kgyf_, d1kgyg_, d1kgyh_

Details for d1kgyd_

PDB Entry: 1kgy (more details), 2.7 Å

PDB Description: crystal structure of the ephb2-ephrinb2 complex

SCOP Domain Sequences for d1kgyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgyd_ b.18.1.4 (D:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
r

SCOP Domain Coordinates for d1kgyd_:

Click to download the PDB-style file with coordinates for d1kgyd_.
(The format of our PDB-style files is described here.)

Timeline for d1kgyd_: