Lineage for d1kgyc_ (1kgy C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777058Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1777063Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species)
  7. 1777064Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries)
    Uniprot P54763 27-207
  8. 1777069Domain d1kgyc_: 1kgy C: [72451]
    Other proteins in same PDB: d1kgye_, d1kgyf_, d1kgyg_, d1kgyh_
    complexed with ephrin b2

Details for d1kgyc_

PDB Entry: 1kgy (more details), 2.7 Å

PDB Description: crystal structure of the ephb2-ephrinb2 complex
PDB Compounds: (C:) ephrin type-b receptor 2

SCOPe Domain Sequences for d1kgyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgyc_ b.18.1.4 (C:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi
rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv
dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp
r

SCOPe Domain Coordinates for d1kgyc_:

Click to download the PDB-style file with coordinates for d1kgyc_.
(The format of our PDB-style files is described here.)

Timeline for d1kgyc_: