Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins) |
Protein Ligand-binding domain of the ephb2 receptor tyrosine kinase [49801] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49802] (4 PDB entries) Uniprot P54763 27-207 |
Domain d1kgyb_: 1kgy B: [72450] Other proteins in same PDB: d1kgye_, d1kgyf_, d1kgyg_, d1kgyh_ complexed with ephrin b2 |
PDB Entry: 1kgy (more details), 2.7 Å
SCOPe Domain Sequences for d1kgyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgyb_ b.18.1.4 (B:) Ligand-binding domain of the ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} aeetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfi rrrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkv dtiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcp r
Timeline for d1kgyb_: