Lineage for d1kfyn2 (1kfy N:1-105)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717622Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 717731Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 717773Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (2 species)
  7. 717774Species Escherichia coli [TaxId:562] [54326] (4 PDB entries)
  8. 717780Domain d1kfyn2: 1kfy N:1-105 [72438]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyo_, d1kfyp_
    complexed with brs, ce1, f3s, fad, fes, fs4, oaa

Details for d1kfyn2

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
PDB Compounds: (N:) fumarate reductase iron-sulfur protein

SCOP Domain Sequences for d1kfyn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyn2 d.15.4.2 (N:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOP Domain Coordinates for d1kfyn2:

Click to download the PDB-style file with coordinates for d1kfyn2.
(The format of our PDB-style files is described here.)

Timeline for d1kfyn2: