Lineage for d1kfyn1 (1kfy N:106-243)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 633252Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 633253Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 633254Protein Fumarate reductase [46550] (2 species)
  7. 633255Species Escherichia coli [TaxId:562] [46551] (4 PDB entries)
  8. 633261Domain d1kfyn1: 1kfy N:106-243 [72437]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn2, d1kfyo_, d1kfyp_
    complexed with brs, ce1, f3s, fad, fes, fs4, oaa

Details for d1kfyn1

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
PDB Compounds: (N:) fumarate reductase iron-sulfur protein

SCOP Domain Sequences for d1kfyn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyn1 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d1kfyn1:

Click to download the PDB-style file with coordinates for d1kfyn1.
(The format of our PDB-style files is described here.)

Timeline for d1kfyn1: