Class a: All alpha proteins [46456] (226 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins) |
Protein Fumarate reductase [46550] (2 species) |
Species Escherichia coli [TaxId:562] [46551] (3 PDB entries) |
Domain d1kfyn1: 1kfy N:106-243 [72437] Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn2, d1kfyo_, d1kfyp_ complexed with brs, ce1, f3s, fad, fes, fs4, oaa |
PDB Entry: 1kfy (more details), 3.6 Å
SCOP Domain Sequences for d1kfyn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfyn1 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d1kfyn1: