Lineage for d1kfym2 (1kfy M:0-225,M:358-442)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096891Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 protein domains)
  6. 2096930Protein Fumarate reductase [51937] (2 species)
  7. 2096931Species Escherichia coli [TaxId:562] [51938] (5 PDB entries)
  8. 2096937Domain d1kfym2: 1kfy M:0-225,M:358-442 [72435]
    Other proteins in same PDB: d1kfya1, d1kfya3, d1kfyb1, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym3, d1kfyn1, d1kfyn2, d1kfyo_, d1kfyp_
    complexed with brs, ce1, f3s, fad, fes, oaa, sf4

Details for d1kfym2

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
PDB Compounds: (M:) fumarate reductase flavoprotein

SCOPe Domain Sequences for d1kfym2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfym2 c.3.1.4 (M:0-225,M:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}
mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdXmggietdqncetr
ikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagngneaaieaqaa
gveqrlkdlvnq

SCOPe Domain Coordinates for d1kfym2:

Click to download the PDB-style file with coordinates for d1kfym2.
(The format of our PDB-style files is described here.)

Timeline for d1kfym2: