Lineage for d1kfyd_ (1kfy D:)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745424Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 745476Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 745488Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 745499Protein Fumarate reductase subunit FrdD [81372] (1 species)
  7. 745500Species Escherichia coli [TaxId:562] [81371] (4 PDB entries)
    is not known to bind heme
  8. 745505Domain d1kfyd_: 1kfy D: [72433]
    Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyb2, d1kfyc_, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyn2, d1kfyo_

Details for d1kfyd_

PDB Entry: 1kfy (more details), 3.6 Å

PDB Description: quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
PDB Compounds: (D:) fumarate reductase 13 kda hydrophobic protein

SCOP Domain Sequences for d1kfyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfyd_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOP Domain Coordinates for d1kfyd_:

Click to download the PDB-style file with coordinates for d1kfyd_.
(The format of our PDB-style files is described here.)

Timeline for d1kfyd_: