Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein Fumarate reductase subunit FrdC [81370] (2 species) |
Species Escherichia coli [TaxId:562] [81369] (5 PDB entries) is not known to bind heme |
Domain d1kfyc_: 1kfy C: [72432] Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyb2, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyn2, d1kfyp_ complexed with brs, ce1, f3s, fad, fes, oaa, sf4 |
PDB Entry: 1kfy (more details), 3.6 Å
SCOPe Domain Sequences for d1kfyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfyc_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]} ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat ivilfvalyw
Timeline for d1kfyc_: