Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species) |
Species Escherichia coli [TaxId:562] [54326] (6 PDB entries) |
Domain d1kfyb2: 1kfy B:1-105 [72431] Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb1, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn1, d1kfyo_, d1kfyp_ complexed with brs, ce1, f3s, fad, fes, oaa, sf4 |
PDB Entry: 1kfy (more details), 3.6 Å
SCOPe Domain Sequences for d1kfyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfyb2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd
Timeline for d1kfyb2: