![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
![]() | Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
![]() | Protein Fumarate reductase [46550] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [46551] (6 PDB entries) |
![]() | Domain d1kfyb1: 1kfy B:106-243 [72430] Other proteins in same PDB: d1kfya1, d1kfya2, d1kfya3, d1kfyb2, d1kfyc_, d1kfyd_, d1kfym1, d1kfym2, d1kfym3, d1kfyn2, d1kfyo_, d1kfyp_ complexed with brs, ce1, f3s, fad, fes, oaa, sf4 |
PDB Entry: 1kfy (more details), 3.6 Å
SCOPe Domain Sequences for d1kfyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfyb1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq qgkvesskdfliatlkpr
Timeline for d1kfyb1: