Lineage for d1kfra_ (1kfr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301588Protein Trematode hemoglobin/myoglobin [63438] (1 species)
  7. 2301589Species Paramphistomum epiclitum [TaxId:54403] [63439] (2 PDB entries)
  8. 2301592Domain d1kfra_: 1kfr A: [72424]
    complexed with hem, so4

Details for d1kfra_

PDB Entry: 1kfr (more details), 1.85 Å

PDB Description: Structural plasticity in the eight-helix fold of a trematode hemoglobin
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1kfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfra_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}
tltkheqdillkelgphvdtpahivetglgayhalftahpqyishfsrleghtienvmqs
dgikhyartlteaivhmlkeisndaevkkiaaqygkdhtsrkvtkdefmsgepiftkyfq
nlvadaegkaavekflkhvfpmmaaei

SCOPe Domain Coordinates for d1kfra_:

Click to download the PDB-style file with coordinates for d1kfra_.
(The format of our PDB-style files is described here.)

Timeline for d1kfra_: