![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
![]() | Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species) |
![]() | Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries) |
![]() | Domain d1kflh1: 1kfl H:2-350 [72420] Other proteins in same PDB: d1kfla2, d1kflb2, d1kflc2, d1kfld2, d1kfle2, d1kflf2, d1kflg2, d1kflh2 complexed with mn, pep, phe, so4 |
PDB Entry: 1kfl (more details), 2.8 Å
SCOPe Domain Sequences for d1kflh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kflh1 c.1.10.4 (H:2-350) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]} nyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpc sihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqind glriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglsc pvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepny sakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmv eshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
Timeline for d1kflh1: