SCOPe 2.06: Domain d1kflf1: 1kfl F:2-350

Lineage for d1kflf1 (1kfl F:2-350)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)

7. Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)

8. Domain d1kflf1: 1kfl F:2-350 [72418]
   Other proteins in same PDB: d1kfla2, d1kflb2, d1kflc2, d1kfld2, d1kfle2, d1kflf2, d1kflg2, d1kflh2
   complexed with mn, pep, phe, so4

Details for d1kflf1

PDB Entry: 1kfl, 2.8 Å

PDB Description: Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from E.coli complexed with Mn2+, PEP, and Phe

PDB Compounds: (F:) 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase

SCOPe Domain Sequences for d1kflf1:

Sequence; same for both SEQRES and ATOM records:

>d1kflf1 c.1.10.4 (F:2-350) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]}
nyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpc
sihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqind
glriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglsc
pvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepny
sakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmv
eshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

Timeline for d1kflf1:

• d1kflf1 first appeared in SCOP 1.61, called d1kflf_
  
• d1kflf1 was called d1kflf_ in SCOPe 2.05
  
• d1kflf1 appears in SCOPe 2.07
  
• d1kflf1 appears in the current release, SCOPe 2.08