Lineage for d1kflc_ (1kfl C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 684412Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 684413Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 684465Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)
  8. 684480Domain d1kflc_: 1kfl C: [72415]

Details for d1kflc_

PDB Entry: 1kfl (more details), 2.8 Å

PDB Description: Crystal structure of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from E.coli complexed with Mn2+, PEP, and Phe
PDB Compounds: (C:) 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase

SCOP Domain Sequences for d1kflc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kflc_ c.1.10.4 (C:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]}
mnyqnddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigp
csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1kflc_:

Click to download the PDB-style file with coordinates for d1kflc_.
(The format of our PDB-style files is described here.)

Timeline for d1kflc_: