SCOP 1.73: Domain d1kffb_: 1kff B:

Lineage for d1kffb_ (1kff B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)

8. Domain d1kffb_: 1kff B: [72409]

Details for d1kffb_

PDB Entry: 1kff, 1.9 Å

PDB Description: an engineered streptavidin with improved affinity for the strep-tag ii peptide: apo-sam1

PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d1kffb_:

Sequence; same for both SEQRES and ATOM records:

>d1kffb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyvtargnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d1kffb_:

• d1kffb_ first appeared in SCOP 1.61
  
• d1kffb_ appears in SCOP 1.71
  
• d1kffb_ appears in SCOP 1.75
  
• d1kffb_ appears in the current release, SCOPe 2.08