Lineage for d1kf6d_ (1kf6 D:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253424Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2253444Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2253462Protein Fumarate reductase subunit FrdD [81372] (2 species)
  7. 2253466Species Escherichia coli [TaxId:562] [81371] (6 PDB entries)
    is not known to bind heme
  8. 2253467Domain d1kf6d_: 1kf6 D: [72400]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6b2, d1kf6c_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6n2, d1kf6o_
    complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6d_

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
PDB Compounds: (D:) fumarate reductase 13 kda hydrophobic protein

SCOPe Domain Sequences for d1kf6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6d_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOPe Domain Coordinates for d1kf6d_:

Click to download the PDB-style file with coordinates for d1kf6d_.
(The format of our PDB-style files is described here.)

Timeline for d1kf6d_: