![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein Fumarate reductase subunit FrdD [81372] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [81371] (6 PDB entries) is not known to bind heme |
![]() | Domain d1kf6d_: 1kf6 D: [72400] Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6b2, d1kf6c_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6n2, d1kf6o_ complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4 |
PDB Entry: 1kf6 (more details), 2.7 Å
SCOPe Domain Sequences for d1kf6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kf6d_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]} minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
Timeline for d1kf6d_: