SCOPe 2.05: Domain d1kf6c_: 1kf6 C:

Lineage for d1kf6c_ (1kf6 C:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Fumarate reductase subunit FrdC [81370] (2 species)

7. Species Escherichia coli [TaxId:562] [81369] (5 PDB entries)
   is not known to bind heme

8. Domain d1kf6c_: 1kf6 C: [72399]
   Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6b2, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6n2, d1kf6p_
   complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6c_

PDB Entry: 1kf6, 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO

PDB Compounds: (C:) fumarate reductase 15 kda hydrophobic protein

SCOPe Domain Sequences for d1kf6c_:

Sequence; same for both SEQRES and ATOM records:

>d1kf6c_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

Timeline for d1kf6c_:

• d1kf6c_ first appeared in SCOP 1.61
  
• d1kf6c_ appears in SCOPe 2.04
  
• d1kf6c_ appears in SCOPe 2.06
  
• d1kf6c_ appears in the current release, SCOPe 2.08