Lineage for d1kf6b1 (1kf6 B:106-243)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 437265Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 437266Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 437267Protein Fumarate reductase [46550] (2 species)
  7. 437268Species Escherichia coli [TaxId:562] [46551] (3 PDB entries)
  8. 437269Domain d1kf6b1: 1kf6 B:106-243 [72397]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n2, d1kf6o_, d1kf6p_

Details for d1kf6b1

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO

SCOP Domain Sequences for d1kf6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d1kf6b1:

Click to download the PDB-style file with coordinates for d1kf6b1.
(The format of our PDB-style files is described here.)

Timeline for d1kf6b1: