Lineage for d1keyd_ (1key D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007879Superfamily a.118.16: Translin [74784] (2 families) (S)
    automatically mapped to Pfam PF01997
  5. 2007880Family a.118.16.1: Translin [74785] (2 protein domains)
  6. 2007881Protein Translin [74786] (2 species)
    synonym: testis/brain RNA-binding protein, TB-RBP
  7. 2007887Species Mouse (Mus musculus) [TaxId:10090] [74787] (1 PDB entry)
  8. 2007891Domain d1keyd_: 1key D: [72392]
    Other proteins in same PDB: d1keyb2

Details for d1keyd_

PDB Entry: 1key (more details), 2.65 Å

PDB Description: Crystal Structure of Mouse Testis/Brain RNA-binding Protein (TB-RBP)
PDB Compounds: (D:) Translin

SCOPe Domain Sequences for d1keyd_:

Sequence, based on SEQRES records: (download)

>d1keyd_ a.118.16.1 (D:) Translin {Mouse (Mus musculus) [TaxId: 10090]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqdipkrclk
arehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt
eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg
frllnlkndslrkrydglkydvkkveevvydlsirg

Sequence, based on observed residues (ATOM records): (download)

>d1keyd_ a.118.16.1 (D:) Translin {Mouse (Mus musculus) [TaxId: 10090]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqdipkrclkarehf
stvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavteilgi
epdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsgfrlln
lkndslrkrydglkydvkkveevvydlsirg

SCOPe Domain Coordinates for d1keyd_:

Click to download the PDB-style file with coordinates for d1keyd_.
(The format of our PDB-style files is described here.)

Timeline for d1keyd_: