Lineage for d1keyb1 (1key B:1-218)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340432Superfamily a.118.16: Translin [74784] (2 families) (S)
    automatically mapped to Pfam PF01997
  5. 2340433Family a.118.16.1: Translin [74785] (2 proteins)
  6. 2340434Protein Translin [74786] (2 species)
    synonym: testis/brain RNA-binding protein, TB-RBP
  7. 2340440Species Mouse (Mus musculus) [TaxId:10090] [74787] (1 PDB entry)
  8. 2340442Domain d1keyb1: 1key B:1-218 [72390]
    Other proteins in same PDB: d1keyb2

Details for d1keyb1

PDB Entry: 1key (more details), 2.65 Å

PDB Description: Crystal Structure of Mouse Testis/Brain RNA-binding Protein (TB-RBP)
PDB Compounds: (B:) Translin

SCOPe Domain Sequences for d1keyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keyb1 a.118.16.1 (B:1-218) Translin {Mouse (Mus musculus) [TaxId: 10090]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqdipkrclk
arehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt
eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg
frllnlkndslrkrydglkydvkkveevvydlsirgfn

SCOPe Domain Coordinates for d1keyb1:

Click to download the PDB-style file with coordinates for d1keyb1.
(The format of our PDB-style files is described here.)

Timeline for d1keyb1: