Lineage for d1keyb_ (1key B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746556Superfamily a.118.16: Translin [74784] (2 families) (S)
    automatically mapped to Pfam PF01997
  5. 1746557Family a.118.16.1: Translin [74785] (2 protein domains)
  6. 1746558Protein Translin [74786] (2 species)
    synonym: testis/brain RNA-binding protein, TB-RBP
  7. 1746564Species Mouse (Mus musculus) [TaxId:10090] [74787] (1 PDB entry)
  8. 1746566Domain d1keyb_: 1key B: [72390]

Details for d1keyb_

PDB Entry: 1key (more details), 2.65 Å

PDB Description: Crystal Structure of Mouse Testis/Brain RNA-binding Protein (TB-RBP)
PDB Compounds: (B:) Translin

SCOPe Domain Sequences for d1keyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keyb_ a.118.16.1 (B:) Translin {Mouse (Mus musculus) [TaxId: 10090]}
fatmsvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgtgfqdipkr
clkarehfstvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtre
avteilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfinel
dsgfrllnlkndslrkrydglkydvkkveevvydlsirgfn

SCOPe Domain Coordinates for d1keyb_:

Click to download the PDB-style file with coordinates for d1keyb_.
(The format of our PDB-style files is described here.)

Timeline for d1keyb_: