Lineage for d1keqa_ (1keq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2422097Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries)
  8. 2422098Domain d1keqa_: 1keq A: [72387]
    complexed with 4mz, acy, k, zn

Details for d1keqa_

PDB Entry: 1keq (more details), 1.88 Å

PDB Description: crystal structure of f65a/y131c carbonic anhydrase v, covalently modified with 4-chloromethylimidazole
PDB Compounds: (A:) F65A/Y131C-MI Carbonic Anhydrase V

SCOPe Domain Sequences for d1keqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyafqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenckkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfrl

SCOPe Domain Coordinates for d1keqa_:

Click to download the PDB-style file with coordinates for d1keqa_.
(The format of our PDB-style files is described here.)

Timeline for d1keqa_: