Lineage for d1keqa_ (1keq A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) 
Species Mouse (Mus musculus), liver, isozyme V [TaxId:10090] [51078] (4 PDB entries) 
Domain d1keqa_: 1keq A: [72387]
Details for d1keqa_
PDB Entry: 1keq (more details), 1.88 Å
PDB Description: crystal structure of f65a/y131c carbonic anhydrase v, covalently modified with 4-chloromethylimidazole
SCOP Domain Sequences for d1keqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V}
gtrqspiniqwkdsvydpqlaplrvsydaascrylwntgyafqvefddscedsgisggpl
gnhyrlkqfhfhwgatdewgsehavdghtypaelhlvhwnstkyenckkasvgenglavi
gvflklgahhqalqklvdvlpevrhkdtqvamgpfdpsclmpacrdywtypgslttppla
esvtwivqktpvevspsqlsmfrtllfsgrgeeedvmvnnyrplqplrdrklrssfrl
SCOP Domain Coordinates for d1keqa_:
Click to download the PDB-style file with coordinates for d1keqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1keqa_:
- d1keqa_ is new in SCOP 1.61
- d1keqa_ appears in SCOP 1.63
- d1keqa_ appears in the current release, SCOPe 2.08
View in 3D
