SCOP 1.67: Domain d1kenu2: 1ken U:109-213

Lineage for d1kenu2 (1ken U:109-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1kenu2: 1ken U:109-213 [72386]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kent1, d1kent2, d1kenu1
   part of Fab against influenza virus hemagglutinin
   complexed with man, nag

Details for d1kenu2

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenu2:

Sequence; same for both SEQRES and ATOM records:

>d1kenu2 b.1.1.2 (U:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppskiqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1kenu2:

• d1kenu2 first appeared in SCOP 1.61
  
• d1kenu2 appears in SCOP 1.65
  
• d1kenu2 appears in SCOP 1.69
  
• d1kenu2 appears in the current release, SCOPe 2.08