Lineage for d1kent2 (1ken T:121-219)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221357Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74831] (1 PDB entry)
  8. 221360Domain d1kent2: 1ken T:121-219 [72384]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenl1, d1kent1, d1kenu1
    complexed with man, nag

Details for d1kent2

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kent2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kent2 b.1.1.2 (T:121-219) Immunoglobulin (constant domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1kent2:

Click to download the PDB-style file with coordinates for d1kent2.
(The format of our PDB-style files is described here.)

Timeline for d1kent2: