SCOP 1.61: Domain d1kent2: 1ken T:121-219

Lineage for d1kent2 (1ken T:121-219)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74831] (1 PDB entry)

8. Domain d1kent2: 1ken T:121-219 [72384]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenl1, d1kent1, d1kenu1

Details for d1kent2

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kent2:

Sequence; same for both SEQRES and ATOM records:

>d1kent2 b.1.1.2 (T:121-219) Immunoglobulin (constant domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1kent2:

• d1kent2 is new in SCOP 1.61
  
• d1kent2 appears in SCOP 1.63
  
• d1kent2 appears in the current release, SCOPe 2.08