SCOP 1.73: Domain d1kent1: 1ken T:1-120

Lineage for d1kent1 (1ken T:1-120)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (36 PDB entries)

8. Domain d1kent1: 1ken T:1-120 [72383]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl1, d1kenl2, d1kent2, d1kenu1, d1kenu2
   part of Fab against influenza virus hemagglutinin
   complexed with man, nag

Details for d1kent1

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

PDB Compounds: (T:) influenza virus infectivity neutralizing antibody (heavy chain)

SCOP Domain Sequences for d1kent1:

Sequence; same for both SEQRES and ATOM records:

>d1kent1 b.1.1.1 (T:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
dvhlqesgpglvkpsqslsltcyvtgysitsgyywtwirqfpgnklewmgyisydgsnny
npslknrisitrdtsknqfflklnsvtaedtasyycaafyydydfffdywgqgttltvss

Timeline for d1kent1:

• d1kent1 first appeared in SCOP 1.61
  
• d1kent1 appears in SCOP 1.71
  
• d1kent1 appears in SCOP 1.75
  
• d1kent1 appears in the current release, SCOPe 2.08