SCOP 1.61: Domain d1kent1: 1ken T:1-120

Lineage for d1kent1 (1ken T:1-120)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74814] (1 PDB entry)
Domain d1kent1: 1ken T:1-120 [72383]
Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl2, d1kent2, d1kenu2

Details for d1kent1

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kent1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kent1 b.1.1.1 (T:1-120) Immunoglobulin (variable domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
dvhlqesgpglvkpsqslsltcyvtgysitsgyywtwirqfpgnklewmgyisydgsnny
npslknrisitrdtsknqfflklnsvtaedtasyycaafyydydfffdywgqgttltvss

SCOP Domain Coordinates for d1kent1:

Click to download the PDB-style file with coordinates for d1kent1.
(The format of our PDB-style files is described here.)

Timeline for d1kent1: