![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
![]() | Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74814] (1 PDB entry) |
![]() | Domain d1kent1: 1ken T:1-120 [72383] Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl2, d1kent2, d1kenu2 |
PDB Entry: 1ken (more details), 3.5 Å
SCOP Domain Sequences for d1kent1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kent1 b.1.1.1 (T:1-120) Immunoglobulin (variable domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain} dvhlqesgpglvkpsqslsltcyvtgysitsgyywtwirqfpgnklewmgyisydgsnny npslknrisitrdtsknqfflklnsvtaedtasyycaafyydydfffdywgqgttltvss
Timeline for d1kent1: