SCOP 1.61: Domain d1kenl1: 1ken L:1-108

Lineage for d1kenl1 (1ken L:1-108)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74814] (1 PDB entry)

8. Domain d1kenl1: 1ken L:1-108 [72381]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl2, d1kent2, d1kenu2

Details for d1kenl1

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenl1:

Sequence; same for both SEQRES and ATOM records:

>d1kenl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
qivltqspaimsaspgekvtltcsasstitssflywyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissleaedgasyfchqwetfprtfgggtkleik

Timeline for d1kenl1:

• d1kenl1 is new in SCOP 1.61
  
• d1kenl1 appears in SCOP 1.63
  
• d1kenl1 appears in the current release, SCOPe 2.07