Lineage for d1kenh2 (1ken H:121-221)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159679Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74831] (1 PDB entry)
  8. 159680Domain d1kenh2: 1ken H:121-221 [72380]
    Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh1, d1kenl1, d1kent1, d1kenu1

Details for d1kenh2

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kenh2 b.1.1.2 (H:121-221) Immunoglobulin (constant domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1kenh2:

Click to download the PDB-style file with coordinates for d1kenh2.
(The format of our PDB-style files is described here.)

Timeline for d1kenh2: