| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74814] (1 PDB entry) |
| Domain d1kenh1: 1ken H:1-120 [72379] Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl2, d1kent2, d1kenu2 |
PDB Entry: 1ken (more details), 3.5 Å
SCOP Domain Sequences for d1kenh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kenh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
dvhlqesgpglvkpsqslsltcyvtgysitsgyywtwirqfpgnklewmgyisydgsnny
npslknrisitrdtsknqfflklnsvtaedtasyycaafyydydfffdywgqgttltvss
Timeline for d1kenh1: