SCOP 1.63: Domain d1kenh1: 1ken H:1-120

Lineage for d1kenh1 (1ken H:1-120)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab against influenza virus hemagglutinin, (mouse), kappa L chain [74814] (1 PDB entry)

8. Domain d1kenh1: 1ken H:1-120 [72379]
   Other proteins in same PDB: d1kena_, d1kenb_, d1kenc_, d1kend_, d1kene_, d1kenf_, d1kenh2, d1kenl2, d1kent2, d1kenu2

Details for d1kenh1

PDB Entry: 1ken, 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kenh1:

Sequence; same for both SEQRES and ATOM records:

>d1kenh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab against influenza virus hemagglutinin, (mouse), kappa L chain}
dvhlqesgpglvkpsqslsltcyvtgysitsgyywtwirqfpgnklewmgyisydgsnny
npslknrisitrdtsknqfflklnsvtaedtasyycaafyydydfffdywgqgttltvss

Timeline for d1kenh1:

• d1kenh1 first appeared in SCOP 1.61
  
• d1kenh1 appears in SCOP 1.65
  
• d1kenh1 appears in the current release, SCOPe 2.08