Lineage for d1kene_ (1ken E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793348Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 793349Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 793394Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 793395Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 793396Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 793500Domain d1kene_: 1ken E: [72377]
    Other proteins in same PDB: d1kenb_, d1kend_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2
    complexed with man, nag

Details for d1kene_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
PDB Compounds: (E:) hemagglutinin HA1

SCOP Domain Sequences for d1kene_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kene_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d1kene_:

Click to download the PDB-style file with coordinates for d1kene_.
(The format of our PDB-style files is described here.)

Timeline for d1kene_: