Lineage for d1kene_ (1ken E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164168Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 164169Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 164199Family b.19.1.2: Influenza hemagglutinin headpice [49823] (1 protein)
  6. 164200Protein Hemagglutinin [49824] (1 species)
  7. 164201Species Influenza A virus, different strains [TaxId:11320] [49825] (25 PDB entries)
  8. 164250Domain d1kene_: 1ken E: [72377]
    Other proteins in same PDB: d1kenb_, d1kend_, d1kenf_, d1kenh1, d1kenh2, d1kenl1, d1kenl2, d1kent1, d1kent2, d1kenu1, d1kenu2

Details for d1kene_

PDB Entry: 1ken (more details), 3.5 Å

PDB Description: influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition

SCOP Domain Sequences for d1kene_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kene_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d1kene_:

Click to download the PDB-style file with coordinates for d1kene_.
(The format of our PDB-style files is described here.)

Timeline for d1kene_: