Lineage for d1keja1 (1kej A:148-242)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001491Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2001492Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2001713Protein Terminal deoxynucleotidyl transferase [69042] (1 species)
  7. 2001714Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries)
  8. 2001717Domain d1keja1: 1kej A:148-242 [72371]
    Other proteins in same PDB: d1keja3, d1keja4
    complexed with co, dad, na

Details for d1keja1

PDB Entry: 1kej (more details), 3 Å

PDB Description: Crystal Structure of Murine Terminal Deoxynucleotidyl Transferase complexed with ddATP
PDB Compounds: (A:) Terminal deoxynucleotidyltransferase short isoform

SCOPe Domain Sequences for d1keja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keja1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d1keja1:

Click to download the PDB-style file with coordinates for d1keja1.
(The format of our PDB-style files is described here.)

Timeline for d1keja1: