Lineage for d1kefa_ (1kef A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165991Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 165992Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
  5. 165993Family b.36.1.1: PDZ domain [50157] (9 proteins)
  6. 166021Protein Synapse associated protein 90, sap90 [74931] (1 species)
  7. 166022Species Human (Homo sapiens) [TaxId:9606] [74932] (1 PDB entry)
  8. 166023Domain d1kefa_: 1kef A: [72369]

Details for d1kefa_

PDB Entry: 1kef (more details)

PDB Description: pdz1 of sap90

SCOP Domain Sequences for d1kefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kefa_ b.36.1.1 (A:) Synapse associated protein 90, sap90 {Human (Homo sapiens)}
eyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfvn
evdvrevthsaavealkeagsivrlyvmrrkpp

SCOP Domain Coordinates for d1kefa_:

Click to download the PDB-style file with coordinates for d1kefa_.
(The format of our PDB-style files is described here.)

Timeline for d1kefa_: