Lineage for d1kdsb_ (1kds B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266132Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 266133Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 266134Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 266135Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 266148Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (27 PDB entries)
  8. 266180Domain d1kdsb_: 1kds B: [72355]
    complexed with npb

Details for d1kdsb_

PDB Entry: 1kds (more details), 2.15 Å

PDB Description: X-ray crystal structure of AmpC beta-lactamase from E. coli in complex with the inhibitor 3-nitrophenylboronic acid

SCOP Domain Sequences for d1kdsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdsb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1kdsb_:

Click to download the PDB-style file with coordinates for d1kdsb_.
(The format of our PDB-style files is described here.)

Timeline for d1kdsb_: