Lineage for d1kdka_ (1kdk A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663826Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 663862Protein Sex hormone-binding globulin [49945] (1 species)
  7. 663863Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries)
  8. 663866Domain d1kdka_: 1kdk A: [72351]
    complexed with dht

Details for d1kdka_

PDB Entry: 1kdk (more details), 1.7 Å

PDB Description: the structure of the n-terminal lg domain of shbg in crystals soaked with edta
PDB Compounds: (A:) sex hormone-binding globulin

SCOP Domain Sequences for d1kdka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdka_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
dppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlgl
rdgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgpl
tskrhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc

SCOP Domain Coordinates for d1kdka_:

Click to download the PDB-style file with coordinates for d1kdka_.
(The format of our PDB-style files is described here.)

Timeline for d1kdka_: